name | updated | stars | badges |
---|---|---|---|
frigate NVR with realtime local object detection for IP cameras | 15 hours ago | 14755 | aicameragoogle-coral |
airflow Apache Airflow - A platform to programmatically author, schedule, and monitor workflows | 15 hours ago | 34501 | airflowapacheapache-airflow |
opendbc democratize access to car decoder rings | 15 hours ago | 1712 | |
federated A framework for implementing federated learning | 15 hours ago | 2279 | |
synapse Synapse: Matrix homeserver written in Python/Twisted. | 15 hours ago | 702 | |
abstra-lib Python-based BPM | 15 hours ago | 125 | bpmbpmnbusiness-process-automation |
core :house_with_garden: Open source home automation that puts local control and privacy first. | 15 hours ago | 68650 | asynciohacktoberfesthome-automation |
consumerfinance.gov Django project protecting American consumers | 15 hours ago | 250 | djangohacktoberfestpython |
zulip Zulip server and web application. Open-source team chat that helps teams stay productive and focused. | 16 hours ago | 20056 | apachechatcollaboration |
meld Read-only mirror of https://gitlab.gnome.org/GNOME/meld | 16 hours ago | 1021 | |
RoboticsAcademy Learn Robotics with JdeRobot | 16 hours ago | 301 | computer-visiongazeborobotics |
server The Triton Inference Server provides an optimized cloud and edge inferencing solution. | 16 hours ago | 7341 | clouddatacenterdeep-learning |
posthog 🦔 PostHog provides open-source product analytics, session recording, feature flagging and A/B testing that you can self-host. | 16 hours ago | 17184 | ab-testinganalyticsexperiments |
wger Self hosted FLOSS fitness/workout, nutrition and weight tracker | 16 hours ago | 2790 | djangofitnessgym |
OpenMDAO OpenMDAO repository. | 16 hours ago | 500 | frameworknasaopen-source |
mealie Mealie is a self hosted recipe manager and meal planner with a RestAPI backend and a reactive frontend application built in Vue for a pleasant user experience for the whole family. Easily add recipes | 16 hours ago | 5255 | hacktoberfesthacktoberfest2022meal-plans |
paperless-ngx A community-supported supercharged version of paperless: scan, index and archive all your physical documents | 16 hours ago | 16811 | angulararchivingdjango |
spikeinterface A Python-based module for creating flexible and robust spike sorting pipelines. | 16 hours ago | 408 | electrophysiologyneurosciencespike-sorting |
onionshare Securely and anonymously share files, host websites, and chat with friends using the Tor network | 16 hours ago | 6038 | cross-platformfile-sharingonion-service |
pretix Ticket shop application for conferences, festivals, concerts, tech events, shows, exhibitions, workshops, barcamps, etc. | 16 hours ago | 1685 | conferencesdjangoevents |
mne-python MNE: Magnetoencephalography (MEG) and Electroencephalography (EEG) in Python | 16 hours ago | 2550 | ecogeegelectrocorticography |
napari napari: a fast, interactive, multi-dimensional image viewer for python | 17 hours ago | 2062 | naparinumpypython |
python-client Python language bindings for Appium | 17 hours ago | 1602 | |
apprise Apprise - Push Notifications that work with just about every platform! | 17 hours ago | 10461 | alertsappriseframework |
InvenTree Description This iOS app integrates natively with the InvenTree open source inventory management and stock control database. With tightly integrated barcode scanning functionality, the app provides | 17 hours ago | 3719 | djangohacktoberfestpython |
jetson-containers Machine Learning Containers for NVIDIA Jetson and JetPack-L4T | 17 hours ago | 1654 | containersdockerdockerfiles |
pytest The pytest framework makes it easy to write small tests, yet scales to support complex functional testing | 17 hours ago | 11372 | hacktoberfestpythontest |
qtpy Provides an uniform layer to support PyQt5, PySide2, PyQt6, PySide6 with a single codebase | 17 hours ago | 928 | closemberpyqtpyqt6 |
bloom A release automation tool which makes releasing catkin (http://ros.org/wiki/catkin) packages easier. | 17 hours ago | 56 | |
searxng SearXNG is a free internet metasearch engine which aggregates results from various search services and databases. Users are neither tracked nor profiled. | 17 hours ago | 8344 | hacktoberfestmetasearchmetasearch-engine |
ckan CKAN is an open-source DMS (data management system) for powering data hubs and data portals. CKAN makes it easy to publish, share and use data. It powers catalog.data.gov, open.canada.ca/data, data.hu | 17 hours ago | 4254 | apicatalogckan |
lotus Open Source Pricing & Packaging Infrastructure | 18 hours ago | 1658 | analyticsapibilling |
eds-scikit eds-scikit is a Python library providing tools to process and analyse OMOP data | 18 hours ago | 31 | clinical-data-warehousedata-sciencemedical |
mathesar Web application providing an intuitive user experience to databases. | 18 hours ago | 2205 | airtable-alternativeautomatic-apidatabase-gui |
Arcticons A monotone line-based icon pack for android | 19 hours ago | 840 | androidf-droidfdroid |
psychopy For running psychology and neuroscience experiments | 19 hours ago | 1606 | experimentexperiment-controlexperimental-design |
dipy DIPY is the paragon 3D/4D+ imaging library in Python. Contains generic methods for spatial normalization, signal processing, machine learning, statistical analysis and visualization of medical images. | 19 hours ago | 669 | bundlescontextual-enhancementdenoising |
android Delta Icons for Android | 19 hours ago | 515 | 2023androidcustomization |
kaapana Kaapana (from the hawaiian word kaʻāpana, meaning “distributor” or “part”) is an open source toolkit for state of the art platform provisioning in the field of medical data analysis. The applications | 20 hours ago | 146 | aicloud-computingimaging |
goth Golem Test Harness, an integration testing framework for yagna - the (new) Golem Network client. | 20 hours ago | 10 | developer-toolsgolemintegration-testing |
gramps-web-api A RESTful web API for Gramps | 20 hours ago | 65 | |
erpnext Free and Open Source Enterprise Resource Planning (ERP) | 20 hours ago | 16952 | accountingasset-managementcrm |
MONAI AI Toolkit for Healthcare Imaging | 20 hours ago | 5327 | deep-learninghealthcare-imagingmedical-image-computing |
pyvista 3D plotting and mesh analysis through a streamlined interface for the Visualization Toolkit (VTK) | 20 hours ago | 2360 | 3dhacktoberfestmesh |
20 hours ago | 15 | ||
nova-utils Metadata & configs for client apps in Polkadot & Kusama ecosystem | 20 hours ago | 17 | blockchaindappspolkadot |
open-simulation-interface A generic interface for the environmental perception of automated driving functions in virtual scenarios. | 20 hours ago | 260 | asamopen-simulation-interfaceosi |
colcon-core Command line tool to build sets of software packages | 20 hours ago | 96 | build-toolcolcon |
plotly.py The interactive graphing library for Python :sparkles: This project now includes Plotly Express! | 21 hours ago | 15277 | d3dashboarddeclarative |
ehrapy Electronic Health Record Analysis with Python. | 21 hours ago | 117 | ehrelectronic-health-recordelectronic-medical-record |
kiss-icp A LiDAR odometry pipeline that just works | 21 hours ago | 1353 | 3d-mappingicplidar-slam |
flagsmith Open Source Feature Flagging and Remote Config Service. Host on-prem or use our hosted version at https://flagsmith.com/ | 21 hours ago | 4290 | cdcicontinuous-integration |
Meshroom 3D Reconstruction Software | 21 hours ago | 10580 | 3d-reconstructionalicevisioncamera-tracking |
scenario_runner Traffic scenario definition and execution engine | 21 hours ago | 473 | carlaopenscenariotraffic-scenario |
jupyter-book Create beautiful, publication-quality books and documents from computational content. | 21 hours ago | 3691 | documentation-generatorjupytersphinx-doc |
mir_robot ROS support for the MiR Robots. This is a community project to use the MiR Robots with ROS. It is not affiliated with Mobile Industrial Robots. | 22 hours ago | 215 | |
Kiwi open source test management system with over 2 million downloads! | 22 hours ago | 931 | managementqaqa-team |
wagtail_editorjs EditorJS Wagtail widget with page, document and image- chooser functionality. | 22 hours ago | 5 | djangopythonpython3 |
GraphQLer ☸The first ever dependency-aware GraphQL API testing tool! | 22 hours ago | 40 | apiapi-testing-frameworkautomated-testing |
romm A beautiful, powerful, self-hosted rom manager | 22 hours ago | 1186 | emulationopen-sourceretrogaming |
CityEnergyAnalyst The City Energy Analyst (CEA) | 22 hours ago | 185 | |
tracim Threads, files and pages with status and full history. All in the same place. | 22 hours ago | 201 | |
weblate Web based localization tool with tight version control integration. | 23 hours ago | 4228 | continuous-localizationcrowdsourcingdjango |
thingsboard-gateway Open-source IoT Gateway - integrates devices connected to legacy and third-party systems with ThingsBoard IoT Platform using Modbus, CAN bus, BACnet, BLE, OPC-UA, MQTT, ODBC and REST protocols | 23 hours ago | 1583 | awsaws-iotbacnet |
KiBot KiCad automation utility | 23 hours ago | 506 | 3d-modelsautomationbom |
tubearchivist Your self hosted YouTube media server | 23 hours ago | 4054 | archivedownload-managerdownload-videos |
pretalx Conference planning tool: CfP, scheduling, speaker management | yesterday | 661 | call-for-papercall-for-paperscfp |
yesterday | 74 | ||
eo-learn Earth observation processing framework for machine learning in Python | yesterday | 1078 | eo-dataeo-researchmachine-learning |
pylint It's not just a linter that annoys you! | yesterday | 5113 | closembercode-qualityhacktoberfest |
compas_fab Robotic fabrication package for the COMPAS Framework. | yesterday | 104 | aecarchitecturecompas |
jupyterhub Multi-user server for Jupyter notebooks | yesterday | 7577 | ipythonjupyter-notebookjupyterhub |
OCRmyPDF OCRmyPDF adds an OCR text layer to scanned PDF files, allowing them to be searched | yesterday | 11996 | image-processingocrpdf |
golem-stats-backend The backend serving https://stats.golem.network with data. It's available at https://api.stats.golem.network | yesterday | 1 | golem |
porcupine On-device wake word detection powered by deep learning | yesterday | 3429 | handsfreehotwordhotword-detection |
WireViz Easily document cables and wiring harnesses. | yesterday | 4043 | cablesconnectorshardware |
healthchecks Open-source cron job and background task monitoring service, written in Python & Django | yesterday | 7296 | croncron-jobsdevops |
bracket Selfhosted tournament system with web interface | yesterday | 118 | apibracketbrackets |
rero-ils Integrated Library System flavour of Invenio by RERO+. | yesterday | 66 | ilsinveniolibrary-management-system |
canopen CANopen for Python | yesterday | 411 | cancanopenpython |
isso a Disqus alternative | yesterday | 4963 | commentingdisqusjavascript |
ArchiveBox 🗃 Open source self-hosted web archiving. Takes URLs/browser history/bookmarks/Pocket/Pinboard/etc., saves HTML, JS, PDFs, media, and more... | yesterday | 19775 | archiveboxbackupsbookmark-archiver |
Wagtail-Pipit Pipit is a Wagtail CMS boilerplate which aims to provide an easy and modern developer workflow with a React-rendered frontend. | yesterday | 225 | ansibleboilerplatecookiecutter |
sickchill Less rage, more chill. | yesterday | 2378 | dognzbepisodeskodi |
librephotos A self-hosted open source photo management service. This is the repository of the backend. | yesterday | 6520 | djangoexifhacktoberfest |
weewx WeeWX code repository | yesterday | 967 | fine-offsetpythonraspberry-pi |
selene User-oriented Web UI browser tests in Python | yesterday | 668 | automatione2e-testingpython |
fail2ban Daemon to ban hosts that cause multiple authentication errors | yesterday | 10451 | anti-botattack-preventionban-hosts |
openpilot openpilot is an open source driver assistance system. openpilot performs the functions of Automated Lane Centering and Adaptive Cruise Control for 250+ supported car makes and models. | yesterday | 47526 | |
OctoPrint OctoPrint is the snappy web interface for your 3D printer! | yesterday | 8012 | 3d-printeroctoprintpython |
biolink-model Schema and generated objects for biolink data model and upper ontology | yesterday | 165 | biolinkdatamodelgene-ontology |
biopython Official git repository for Biopython (originally converted from CVS) | yesterday | 4169 | bioinformaticsbiopythondna |
reader A Python feed reader library. | yesterday | 416 | atom-feedfeedfeed-aggregator |
cantools CAN bus tools. | 2 days ago | 1737 | arxmlcan-buscdd |
nhs-number Python package to provide utilities for NHS Numbers, including validity checks, normalisation, and generation. | 2 days ago | 5 | fcinhsnhsnumber |
copyparty Portable file server with accelerated resumable uploads, dedup, WebDAV, FTP, TFTP, zeroconf, media indexer, thumbnails++ all in one file, no deps | 2 days ago | 445 | copypartyfile-serverfile-sharing |
python-gitlab A python wrapper for the GitLab API. | 2 days ago | 2163 | apigitlabgitlab-api |
toot toot - Mastodon CLI & TUI | 2 days ago | 1102 | climastodonpython |
whoogle-search A self-hosted, ad-free, privacy-respecting metasearch engine | 2 days ago | 8800 | adblockdockereasy-deploy |
cookiecutter-wagtail-vix a minimal, batteries-included, reusable project skeleton to serve as a starting point for a Wagtail project. | 2 days ago | 25 | cookiecuttercookiecutter-templatedjango |
reviewboard An extensible and friendly code review tool for projects and companies of all sizes. | 2 days ago | 1533 | code-reviewcodereviewdeveloper-tools |
changedetection.io The best and simplest free open source web page change detection, website watcher, restock monitor and notification service. Restock Monitor, change detection. Designed for simplicity - Simply monito | 2 days ago | 14909 | back-in-stockchange-alertchange-detection |
securedrop.org Code for the SecureDrop project website | 2 days ago | 39 | |
Shifter A simple, self-hosted file-sharing web app, powered by Django | 2 days ago | 18 | djangodockerfile-sharing |
prowler Prowler is an Open Source Security tool for AWS, Azure, GCP and Kubernetes to do security assessments, audits, incident response, compliance, continuous monitoring, hardening and forensics readiness. | 2 days ago | 9547 | awsazurecis-benchmark |
evm-semantics K Semantics of the Ethereum Virtual Machine (EVM) | 2 days ago | 496 | |
Deep_Object_Pose Deep Object Pose Estimation (DOPE) – ROS inference (CoRL 2018) | 2 days ago | 959 | |
OctoBot Open source crypto trading bot | 2 days ago | 2920 | algorithmic-tradingarbitragebacktesting |
ansible-lint ansible-lint checks playbooks for practices and behavior that could potentially be improved and can fix some of the most common ones for you | 2 days ago | 3333 | ansibleansible-dev-toolsansible-lint |
cyclops Toolkit for health AI implementation | 2 days ago | 66 | clinical-dataclinical-decision-supportclinical-research |
weevely3 Weaponized web shell | 2 days ago | 3068 | |
satpy Python package for earth-observing satellite data processing | 2 days ago | 1008 | closemberdaskhacktoberfest |
swingmusic Swing Music is a beautiful, self-hosted music player for your local audio files. Like a cooler Spotify ... but bring your own music. | 2 days ago | 602 | media-streamermusicmusic-server |
readthedocs.org The source code that powers readthedocs.org | 2 days ago | 7872 | docsmkdocspython |
algojig A development and testing jig for Algorand | 2 days ago | 13 | |
content-manager Gestionnaire de contenu permettant de créer et gérer un site internet basé sur le Système de design de l'État, accessible et responsive | 2 days ago | 23 | |
PayloadsAllTheThings A list of useful payloads and bypass for Web Application Security and Pentest/CTF | 2 days ago | 56794 | bountybugbountybypass |
2 days ago | 3 | ||
CAPEv2 Malware Configuration And Payload Extraction | 2 days ago | 1669 | capeconfigsdebugging-tools |
nibabel Python package to access a cacophony of neuro-imaging file formats | 2 days ago | 625 | afni-brik-headbrain-imagingcifti-2 |
sigma Main Sigma Rule Repository | 2 days ago | 7624 | elasticsearchidslogging |
finn Dataflow compiler for QNN inference on FPGAs | 2 days ago | 664 | compilerdataflowfpga |
canarytokens Canarytokens helps track activity and actions on your network. | 2 days ago | 1655 | |
dftimewolf A framework for orchestrating forensic collection, processing and data export | 2 days ago | 273 | |
caldera Automated Adversary Emulation Platform | 2 days ago | 5179 | adversary-emulationcalderacybersecurity |
volatility3 Volatility 3.0 development | 2 days ago | 2208 | digital-investigationforensicsincident-response |
algokit-cli The Algorand AlgoKit CLI is the one-stop shop tool for developers building on the Algorand network. | 2 days ago | 151 | |
censys-python An easy-to-use and lightweight API wrapper for Censys APIs. | 2 days ago | 374 | apiattack-surface-managementcensys |
LibreTranslate Free and Open Source Machine Translation API. Self-hosted, offline capable and easy to setup. | 2 days ago | 6684 | apimachinetranslate |
doorstop Requirements management using version control. | 2 days ago | 453 | certificationdocumentationhtml |
edsnlp Modular, fast NLP framework, compatible with Pytorch and spaCy, offering tailored support for French clinical notes. | 2 days ago | 95 | clinical-data-warehousedeep-learningfast |
winbindex An index of Windows binaries, including download links for executables such as exe, dll and sys files | 2 days ago | 531 | |
python-can The can package provides controller area network support for Python developers | 2 days ago | 1173 | can-buspython |
pyroSAR framework for large-scale SAR satellite data processing | 2 days ago | 470 | earth-observationgdalpython |
Fiona Fiona reads and writes geographic data files | 2 days ago | 1125 | clicythongdal |
odoo Odoo. Open Source Apps To Grow Your Business. | 2 days ago | 34529 | appsbusinesserp |
OpenCDA A generalized framework for prototyping full-stack cooperative driving automation applications under CARLA+SUMO. | 2 days ago | 962 | automated-driving-systemsautonomous-drivingconnected-and-automated-vehicles |
babybuddy A :baby: buddy to help caregivers track sleep, feedings, diaper changes, and tummy time to learn about and predict baby's needs without (as much) guess work. | 2 days ago | 1930 | babydashboarddjango |
wagtail-cookiecutter-foundation A Cookiecutter template for Wagtail CMS using Zurb Foundation 6 | 3 days ago | 166 | |
zentral Zentral is a high-visibility platform for controlling Apple endpoints in enterprises. It brings great observability to IT and makes tracking & reporting compliance much less manual. | 3 days ago | 720 | apple-mdmelasticsearchendpoint-management |
pyload The free and open-source Download Manager written in pure Python | 3 days ago | 3161 | cyberlockerddldebrid |
fact_extractor Standalone Utility for FACT-like extraction | 3 days ago | 76 | |
playwright-pytest Pytest plugin to write end-to-end browser tests with Playwright. | 3 days ago | 400 | playwrightpytest-plugintesting-tools |
3 days ago | 3 | ||
relate RELATE is an Environment for Learning And TEaching | 3 days ago | 362 | code-homeworkcode-questioncourse-management |
slackblocks :game_die: Python API for Building Messages Using the Slack Block Kit API | 3 days ago | 62 | blockspythonslack |
pvlib-python A set of documented functions for simulating the performance of photovoltaic energy systems. | 3 days ago | 1076 | photovoltaicpythonrenewable-energy |
jetson_stats 📊 Simple package for monitoring and control your NVIDIA Jetson [Orin, Xavier, Nano, TX] series | 3 days ago | 2024 | cpu-monitoringgpugpu-monitoring |
pygments Pygments is a generic syntax highlighter written in Python | 3 days ago | 1702 | pythonsyntax-highlighting |
py-algorand-sdk Algorand Python SDK | 3 days ago | 255 | |
westernfriend.org A website for Western Friend (westernfriend.org), a Quaker publication that provides resources and support for Quaker communities and individuals seeking to live out their faith in the world. Western | 3 days ago | 51 | communitydjangoecommerce |
fava Fava - web interface for Beancount | 3 days ago | 1821 | beancountledgerplaintext-accounting |
cookiecutter-wagtail-package A cookiecutter template for building Wagtail add-on packages | 3 days ago | 14 | djangowagtail |
timetagger Tag your time, get the insight | 3 days ago | 906 | pythontimetracker |
mqtt_bridge mqtt_bridge provides a functionality to bridge between ROS and MQTT in bidirectional | 3 days ago | 151 | |
capa The FLARE team's open-source tool to identify capabilities in executable files. | 3 days ago | 3853 | gsoc-2024malware-analysisreverse-engineering |
dem Containerized Development Environment Manager for embedded development | 3 days ago | 62 | containerizationcontainersdeveloper-tools |
nuscenes-devkit The devkit of the nuScenes dataset. | 3 days ago | 2104 | |
gym-pybullet-drones PyBullet Gymnasium environments for single and multi-agent reinforcement learning of quadcopter control | 3 days ago | 1083 | betaflightcontrolcrazyflie |
safe-control-gym PyBullet CartPole and Quadrotor environments—with CasADi symbolic a priori dynamics—for learning-based control and RL | 3 days ago | 518 | cartpolecasadicontrol |
wagtail-torchbox Wagtail build of Torchbox.com | 3 days ago | 123 | djangopythontorchbox |
cli 🥧 HTTPie CLI — modern, user-friendly command-line HTTP client for the API era. JSON support, colors, sessions, downloads, plugins & more. | 3 days ago | 31867 | apiapi-clientapi-testing |
rainbow_csv 🌈Rainbow CSV - Vim plugin: Highlight columns in CSV and TSV files and run queries in SQL-like language | 3 days ago | 573 | csvsqlsql-like |
docker-android Android in docker solution with noVNC supported and video recording | 3 days ago | 8097 | alibabacloudandroidandroid-emulator |
PySolFC A comprehensive, feature-rich, open source, and portable, collection of Solitaire games. | 4 days ago | 443 | card-gamecardsfreecell-solver |
b2bua Sippy B2BUA is a RFC3261-compliant Session Initiation Protocol (SIP) stack and Back-to-back user agent (B2BUA) server software. | 4 days ago | 164 | |
django-oscar-accounts Managed accounts for Django (with or without django-oscar) | 4 days ago | 210 | |
ihatemoney A simple shared budget manager web application | 4 days ago | 1098 | budget-managerflaskpython |
buku :bookmark: Personal mini-web in text | 4 days ago | 6150 | bookmarkbookmark-managerbookmarks |
mypaas Run your own PaaS using Docker, Traefik, and great analytics | 4 days ago | 367 | analyticsdockerpaas |
OpenAeroStruct OpenAeroStruct is a lightweight tool that performs aerostructural optimization using OpenMDAO. | 4 days ago | 169 | aerodynamicsopen-sourceopenmdao |
Nominatim Open Source search based on OpenStreetMap data | 4 days ago | 2876 | geocodingopenstreetmaposm |
cuscon This icon pack makes your home screen varied and dynamic. As there is no background, each icon looks unique and the constant pattern of the grid is broken up. | 4 days ago | 38 | android-appandroid-icon-packandroid-icons |
bandit Bandit is a tool designed to find common security issues in Python code. | 4 days ago | 5991 | banditlinterpython |
PythonRobotics Python sample codes for robotics algorithms. | 4 days ago | 21718 | algorithmanimationautonomous-driving |
neomodel An Object Graph Mapper (OGM) for the Neo4j graph database. | 4 days ago | 889 | neo4jogmpython |
wagtail-treemodeladmin An extension for Wagtail's ModelAdmin for a page explorer-like navigation of Django model relationships | 4 days ago | 42 | djangohacktoberfestwagtail |
coderedcms Wagtail + CodeRed Extensions enabling rapid development of marketing-focused websites. | 4 days ago | 652 | bootstrapbootstrap5cms |
collective.z3cform.datagridfield Datagrid Field for z3c.forms | 4 days ago | 8 | |
public-apis A collective list of free APIs | 4 days ago | 292132 | apiapisdataset |
dollphone-foss Cute soft icon pack | 4 days ago | 61 | f-droid |
awesome-safety-critical List of resources about programming practices for writing safety-critical software. | 4 days ago | 1520 | awesome-listawesome-listssafety |
otterwiki A minimalstic wiki powered by python, markdown and git. | 4 days ago | 156 | gitmarkdownwiki |
thinc 🔮 A refreshing functional take on deep learning, compatible with your favorite libraries | 4 days ago | 2789 | aiartificial-intelligencedeep-learning |
maltrail Malicious traffic detection system | 4 days ago | 5745 | attack-detectionintrusion-detectionmalware |
guide A website to teach Wagtail CMS to content editors, moderators and administrators. | 4 days ago | 29 | djangohacktoberfesttutorials |
bakerydemo Next generation Wagtail demo, born in Reykjavik | 4 days ago | 882 | hacktoberfestwagtail |
boofuzz A fork and successor of the Sulley Fuzzing Framework | 4 days ago | 1956 | fuzzingpythonsecurity |
proselint A linter for prose. | 4 days ago | 4280 | adviceknowledgelanguage |
ddsp DDSP: Differentiable Digital Signal Processing | 5 days ago | 2777 | |
mido MIDI Objects for Python | 5 days ago | 1341 | midimidifilepython |
ssh-audit SSH server & client security auditing (banner, key exchange, encryption, mac, compression, compatibility, security, etc) | 5 days ago | 3131 | auditingsecurityssh |
python-taiga :evergreen_tree: Python module for communicating with the Taiga API | 5 days ago | 92 | hacktoberfestpythonrest |
wagtailmedia A Wagtail module for managing video and audio files within the admin | 5 days ago | 219 | audiodjangohacktoberfest |
wagtail-markdown Markdown support for Wagtail | 5 days ago | 181 | djangohacktoberfestmarkdown |
wagtail-headless-preview Previews for headless Wagtail setups | 5 days ago | 114 | headlesswagtailwagtail-cms |
collective.z3cform.norobots collective.z3cform.norobots provides a "human" captcha widget based on a list of questions/answers. | 5 days ago | 5 | |
evo Python package for the evaluation of odometry and SLAM | 5 days ago | 3224 | benchmarkeurocevaluation |
klaus docker run klaus / pip install klaus — the first Git web viewer that Just Works™. | 5 days ago | 666 | gitpythonzero-configuration |
kinto A generic JSON document store with sharing and synchronisation capabilities. | 5 days ago | 4297 | apidecentralisationhttp |
python-flask OpenTracing instrumentation for the Flask microframework | last year | 135 | flaskopentracingpython |
chainer-chemistry Chainer Chemistry: A Library for Deep Learning in Biology and Chemistry | last year | 603 | biologychainerchemistry |
outcognito-mode Incognito Mode for extroverts | last year | 12 | |
XSRFProbe The Prime Cross Site Request Forgery (CSRF) Audit and Exploitation Toolkit. | last year | 920 | auditcrafted-tokenscrawler |
TIDoS-Framework The Offensive Manual Web Application Penetration Testing Framework. | last year | 1733 | enumerationexploitationfootprinting |
micropython-lora MicroPython library for controlling a Semtech SX127x LoRa module over SPI. | last year | 26 | |
unoconv Universal Office Converter - Convert between any document format supported by LibreOffice/OpenOffice. | last year | 2468 | |
nsupdate.info Dynamic DNS service | last year | 939 | djangodnsdyndns |
persephone A tool for automatic phoneme transcription | last year | 152 | acoustic-modelsartificial-intelligencemachine-learning |
captcha_solver Universal python API to captcha solving services | last year | 231 | antigateapicaptcha |
Deep-Forest An Efficient, Scalable and Optimized Python Framework for Deep Forest (2021.2.1) | last year | 879 | deep-forestensemble-learningmachine-learning |
turbopilot Turbopilot is an open source large-language-model based code completion engine that runs locally on CPU | last year | 2864 | code-completioncpplanguage-model |
loxigen OpenFlow protocol bindings for multiple languages | last year | 96 | |
mqttwarn Subscribe to MQTT topics (with wildcards) and notify pluggable services | last year | 910 | |
tardis-python Python client for tardis.dev - historical tick-level cryptocurrency market data replay API. | last year | 95 | cryptocurrency-apicryptocurrency-priceshistorical-data |
collective.mailchimp MailChimp integration for Plone. | last year | 5 | |
SX127x_driver_for_MicroPython_on_ESP8266 SX127x (LoRa transceiver) driver for (Micro)Python on ESP8266/ESP32/Raspberry_Pi | last year | 136 | esp32esp8266iot |
micropython-mcp2515 Micropython MCP2515 driver, porting from Arduino MCP2515 CAN interface library | last year | 23 | |
BayesianOptimization A Python implementation of global optimization with gaussian processes. | last year | 6726 | bayesian-optimizationgaussian-processesoptimization |
pysnmp Python SNMP library | last year | 561 | mibpysnmppython |
awesome-decision-tree-papers A collection of research papers on decision, classification and regression trees with implementations. | last year | 2255 | cartcatboostclassification-model |
sen Terminal User Interface for containers. | last year | 948 | containersdockerdocker-tui |
mp_lvgl_widgets Widgets for the MicroPython Port of LVGL | last year | 2 | |
milksnake A setuptools/wheel/cffi extension to embed a binary data in wheels | last year | 787 | tag-production |
Dwarf Full featured multi arch/os debugger built on top of PyQt5 and frida | last year | 1226 | androidcapstone-enginecracking |
dlint Dlint is a tool for encouraging best coding practices and helping ensure Python code is secure. | last year | 162 | dlintflake8linter |
github-issues-import Python script to import issues from one repository into another, either one at a time or all of them at once. | last year | 421 | |
unicode-slugify A slugifier that works in unicode | last year | 319 | |
aminator A tool for creating EBS AMIs. This tool currently works for CentOS/RedHat Linux images and is intended to run on an EC2 instance. | last year | 939 | |
MXFusion Modular Probabilistic Programming on MXNet | last year | 102 | bayesian-inferencemachine-learningmxnet |
Complete_Street_Rule The Complete Street Rule for ArcGIS CityEngine is a scenario oriented design tool intended to enable users to quickly create procedurally generated multimodal streets. | last year | 159 | arcgis-cityenginecgacityengine |
mpy-wpa_supplicant MicroPython wpa-supplicant | last year | 0 | |
soundcloud-python A Python wrapper around the Soundcloud API | last year | 95 | |
igel a delightful machine learning tool that allows you to train, test, and use models without writing code | last year | 3071 | artificial-intelligenceautomationautoml |
python-iocextract Defanged Indicator of Compromise (IOC) Extractor. | last year | 415 | base64decodingdefang |
money Python money class with optional CLDR-backed locale-aware formatting and an extensible currency exchange solution. | last year | 224 | |
CanCat swiss army knife of Controller Area Networks (CAN) often used in cars and building automation, etc... | last year | 190 | |
prospector Inspects Python source files and provides information about type and location of classes, methods etc | last year | 1793 | |
HaboMalHunter HaboMalHunter is a sub-project of Habo Malware Analysis System (https://habo.qq.com), which can be used for automated malware analysis and security assessment on the Linux system. | last year | 722 | dynamic-analysiselflinux |
last year | 8 | ||
auction-demo An example smart contract NFT auction on Algorand | last year | 57 | algorandauctionblockchain |
last year | 29 | ||
MP2300-Tools My collection of tools I've written for the graphtec MP2300 plotter. Demo: | last year | 6 | open-sourceotterplotter |
piccolo_examples Example projects built using Piccolo. | last year | 19 | |
cl4py Common Lisp for Python | last year | 82 | common-lisppython |
ros2-tensorflow ROS2 nodes for computer vision tasks in Tensorflow | last year | 51 | computer-visionimage-classificationimage-detection |
salmon A Python Mail Server | last year | 617 | emaillmtplmtp-server |
tacofancy-api Making an API for https://github.com/sinker/tacofancy | last year | 118 | |
puresnmp Pure Python SNMPv2 Library | last year | 75 | pythonpython-3snmp |
HASS-data-detective Explore and analyse your Home Assistant data | last year | 175 | datadata-sciencehome |
pandas_flavor The easy way to write your own flavor of Pandas | last year | 274 | pandas |
smof Explore and analyze biological sequence data | last year | 14 | bioinformaticsbiologyfasta |
hot-redis Rich Python data types for Redis | last year | 289 | |
cecilia5 Ear-bending noises and music | last year | 205 | |
roboschool DEPRECATED: Open-source software for robot simulation, integrated with OpenAI Gym. | last year | 2082 | |
baselines OpenAI Baselines: high-quality implementations of reinforcement learning algorithms | last year | 14407 | |
flask-reactize flask-reactize is a boostrap to serve any React JS application via a Python back-end, using Flask as web framework. | last year | 7 | |
fastapi-celery Minimal example utilizing fastapi and celery with RabbitMQ for task queue, Redis for celery backend and flower for monitoring the celery tasks. | last year | 448 | celerydocker-composefastapi |
streamingbandit Python application to setup and run streaming (contextual) bandit experiments. | last year | 79 | banditcmabcontextual |
gimel Run your own A/B testing backend using AWS Lambda and Redis HyperLogLog | last year | 227 | |
cstar_perf Apache Cassandra performance testing platform | last year | 72 | |
blender-artnet Blender script to push artnet data to Evee lights | last year | 36 | |
pangu.py Paranoid text spacing in Python | last year | 218 | pangupythontext |
fuck-coding-interviews How on earth can I ever think of a solution like that in an interview?! | last year | 663 | algorithmscoding-interviewsdata-structures |
quant-trading Python quantitative trading strategies including VIX Calculator, Pattern Recognition, Commodity Trading Advisor, Monte Carlo, Options Straddle, Shooting Star, London Breakout, Heikin-Ashi, Pair Tradin | last year | 4804 | algorithmic-tradingbollinger-bandscommodity-trading |
rpg_trajectory_evaluation Toolbox for quantitative trajectory evaluation of VO/VIO | last year | 990 | |
collective.cover A sane, working, editor-friendly way of creating front pages and other composite pages. Working now, for mere mortals. | last year | 48 | |
verible-linter-action Automatic SystemVerilog linting in github actions with the help of Verible | last year | 21 | |
pico-wave-vibration-generator A MicroPython-based frequency generator for Raspberry Pi Pico designed to create vibrations on solenoids or speakers, enabling wave experimentation and exploration at home. | last year | 2 | |
make_gtfs A Python 3.8+ library to build GTFS feeds from basic route information. | last year | 2 | |
ranger-zshz A plugin to integrate zsh-z into ranger. | last year | 4 | |
minipb Lightweight Protocol Buffer serialize/deserialize library | last year | 50 | micropythonprotobuf |
playstation-box Update a pinned gist to contain your PlayStation stats | last year | 13 | awesome-pinned-gistspinned-gistprofile-readme |
eosfactory Python-based EOS smart-contract development & testing framework | last year | 243 | eospythonsmart-contracts |
last year | 168 | ||
matchering 🎚️ Open Source Audio Matching and Mastering | last year | 948 | audiodocker-imagedsp |
mmWave-localization-learning 🎯 ML-based positioning method from mmWave transmissions - with high accuracy and energy efficiency | last year | 106 | 5gbeamformingcnn |
pg_view Get a detailed, real-time view of your PostgreSQL database and system metrics | last year | 489 | monitoring |
bluebert BlueBERT, pre-trained on PubMed abstracts and clinical notes (MIMIC-III). | last year | 537 | bertbert-modellanguage-model |
HyperPose Library for Fast and Flexible Human Pose Estimation | last year | 1239 | computer-visiondistributed-trainingmobilenet |
pyodds An End-to-end Outlier Detection System | last year | 245 | anomaly-detectiondatabasedeep-learning |
rex-gym OpenAI Gym environments for an open-source quadruped robot (SpotMicro) | last year | 962 | artificial-intelligencegym-environmentinverse-kinematics |
trading-rl Deep Reinforcement Learning for Financial Trading using Price Trailing @ ICASSP 2019 | last year | 214 | |
OverlapNet OverlapNet - Loop Closing for 3D LiDAR-based SLAM (chen2020rss) | last year | 633 | 3d-lidarlidarloop-closing |
pylot Modular autonomous driving platform running on the CARLA simulator and real-world vehicles. | last year | 430 | autonomous-drivingautonomous-vehiclescarla |
NeuroNER Named-entity recognition using neural networks. Easy-to-use and state-of-the-art results. | last year | 1672 | deep-learningmachine-learningnamed-entity-recognition |
leafmap A Python package for interactive mapping and geospatial analysis with minimal coding in a Jupyter environment | last year | 1555 | data-sciencedatavizfolium |
mrjob Run MapReduce jobs on Hadoop or Amazon Web Services | last year | 2609 | |
seqlearn Sequence learning toolkit for Python | last year | 667 | |
wagtail-meta-preview Wagtail Meta Preview provides panels for previewing Facebook sharing, Twitter sharing and Google search results in the Wagtail admin. | last year | 25 | metapreviewshare |
Zappa Serverless Python | last year | 11906 | api-gatewayaws-lambdabottle |
typilus-action A GitHub Action for suggesting Python type annotations. | last year | 40 | github-actionsmachine-learningpython3 |
pylint It's not just a linter that annoys you! | last year | 4585 | closembercode-qualityhacktoberfest |
highway-env A minimalist environment for decision-making in autonomous driving | last year | 1712 | autonomous-drivinggym-environmentreinforcement-learning |
Pokemon-Terminal Pokemon terminal themes. | last year | 4153 | bashiterm2linux |
pyramid_storage File upload management for the Pyramid web framework | last year | 13 | |
bda.plone.gtm Google Tag Manager Intergation | last year | 2 | |
unbd Micro implementation of network block device (NBD) for micropython | last year | 2 | |
skater Python Library for Model Interpretation/Explanations | last year | 1065 | attributionblackboxcnn-classification |
captcha_recognize Image Recognition captcha without image segmentation 无需图片分割的验证码识别 | last year | 547 | captchacaptcha-breakingimage-recognition-captchas |
piclock_advanced Clock / Infoscreen for radiostudios | last year | 2 | broadcastinfoscreenradio |
reverse-geocoder A fast, offline reverse geocoder in Python | last year | 1861 | |
cl-project-with-docs Common Lisp project skeleton generator which uses Sphinx and reStructured text to render nice and readable HTML documentation. | last year | 3 | |
meerkat Data acquisition for Raspberry Pi and Micropython | last year | 7 | data-sciencedriversmicropython |
max7219_8digit Micropython driver for the max7219 with 8 x 7segment display | last year | 22 | |
lightning-bolts Toolbox of models, callbacks, and datasets for AI/ML researchers. | last year | 1509 | aiganimage-processing |
awesome-graph-classification A collection of important graph embedding, classification and representation learning papers with implementations. | last year | 4679 | attention-mechanismclassification-algorithmdeep-graph-kernels |
collective.pwexpiry Emulate Active Directory password complexity requirements. | last year | 1 | |
scoop SCOOP (Scalable COncurrent Operations in Python) | last year | 595 | |
threatbus 🚌 Threat Bus – A threat intelligence dissemination layer for open-source security tools. | last year | 255 | cifcif3ids |
infer-types A CLI tool to automatically add type annotations into Python code. Must have tool for annotating existing code. | last year | 66 | annotationscode-formattercode-generation |
code2flow Pretty good call graphs for dynamic languages | last year | 3166 | |
gnss-ins-sim Open-source GNSS + inertial navigation, sensor fusion simulator. Motion trajectory generator, sensor models, and navigation | last year | 1085 | gnssgpsimu |
CapTipper Malicious HTTP traffic explorer | last year | 698 | |
upy-websocket-server Micropython (ESP8266) websocket server implementation. | last year | 73 | |
MINER MINER provided by the paper "MINER: A Hybrid Data-Driven Approach for REST API Fuzzing" | last year | 27 | |
coacervate Coacervate is a free and open-source public good that lets you easily run genomic analyses on an extremely low-cost global supercomputer, democratizing access to the knowledge and infrastructure requi | last year | 4 | bioinformaticsgenomicsgolem |
morefusion MoreFusion: Multi-object Reasoning for 6D Pose Estimation from Volumetric Fusion, CVPR 2020 | last year | 225 | artificial-intelligencecomputer-visiondeep-learning |
jrnl Collect your thoughts and notes without leaving the command line. | last year | 38 | |
slackbot A chat bot for Slack (https://slack.com). | last year | 1255 | |
bcbb Incubator for useful bioinformatics code, primarily in Python and R | last year | 582 | |
scratchrelaxtv :tv: Terraform module development tool. | last year | 27 | |
django-remote-forms A platform independent django form serializer | last year | 224 | |
inkscape-raytracing An extension for Inkscape that makes it easier to draw optical diagrams. | last year | 301 | inkscape-extensionopticsoptics-simulation |
updog Updog is a replacement for Python's SimpleHTTPServer. It allows uploading and downloading via HTTP/S, can set ad hoc SSL certificates and use http basic auth. | last year | 2520 | file-sharingfile-uploadhttp-server |
promformat PromQL formatter | last year | 31 | formatterpromql |
MicroPyDatabase A low-memory json-based database for MicroPython | last year | 16 | |
vim-ros Vim plugin for ROS development | last year | 131 | rosvimvim-plugin |
micropython-hcsr04 Micropython driver for ultrasonic sensor HC-SR04 | last year | 129 | |
cohesion A tool for measuring Python class cohesion. | last year | 220 | classcodecohesion |
Products.PrintingMailHost A monkey patch to send MailHost messages to standard out | last year | 2 | |
datamol Molecular Manipulation Made Easy. | last year | 288 | cheminformaticsdrug-designdrug-discovery |
ziggurat_foundations Framework agnostic set of sqlalchemy classes that make building applications that require permissions an easy task. | last year | 70 | authenticationauthorizationflask |
SwagLyrics-For-Spotify 📃 Get lyrics of currently playing Spotify song so you don't sing along with the wrong ones and embarrass yourself later. Very fast. | last year | 314 | applicationflaskgenius |
last year | 2849 | ||
DS3231micro Micropython library for DS3231 | last year | 15 | |
jupyterlab-quickopen Quickly open a file in JupyterLab by typing part of its name | last year | 75 | jupyterjupyterlabjupyterlab-extension |
cuisine Chef-like functionality for Fabric | last year | 1259 | |
gentle gentle forced aligner | last year | 1337 | |
panic_polkadot 🚨 PANIC for Polkadot | last year | 40 | alerterblockchainmonitoring |
panic_polkadot 🚨 PANIC for Polkadot | last year | 38 | alerterblockchainmonitoring |
micropython-zacwire MicroPython implementation of the ZACwire protocol used in TSic 506F temperature sensors. | last year | 0 | |
ros_jetson_stats 🐢 The ROS jetson-stats wrapper. The status of your NVIDIA jetson in diagnostic messages | last year | 66 | diagnosticsjetson-nanojetson-stats |
masonite-inertia Server-side Masonite adapter for Inertia.js | last year | 23 | inertiajsmasonitemasonite-package |
wagtail-image-import Adds bulk image import from Google Drive to the Wagtail Admin | last year | 11 | |
jupyter-ros2 Jupyter widget helpers for ros2, the Next-Generation of the Robot Operating System | last year | 24 | |
makesite Simple, lightweight, and magic-free static site/blog generator for Python coders | last year | 1742 | |
photonix A modern, web-based photo management server. Run it on your home server and it will let you find the right photo from your collection on any device. Smart filtering is made possible by object recognit | last year | 1647 | aidjangodocker |
spafe :sound: spafe: Simplified Python Audio Features Extraction | last year | 415 | audioaudio-analysisbeat |
HerePy A library that provides a Python interface to the HERE location APIs. | last year | 84 | api-wrapperev-chargingfleet-telematics |
AS5600 AS560 Micropython library for reading this magnetic sensor | last year | 21 | |
dota2 🐸 Python package for interacting with Dota 2 Game Coordinator | last year | 191 | dota2game-coordinatorhacktoberfest |
YeomanPywork 🐍Pywork is a Yeoman generator to scaffold a Bare-bone Python Application | last year | 11 | fastapigeneratorlogzero |
django-slack Slack integration for Django, using the templating engine to generate messages | last year | 238 | |
SRGAN Photo-Realistic Single Image Super-Resolution Using a Generative Adversarial Network | last year | 3140 | cnngansrgan |
WavesGatewayFramework A framework to connect other cryptocurrencies to the Waves platform. | last year | 24 | |
mygpo The gpodder.net webservice | last year | 263 | djangogpodderhacktoberfest |
pyston A faster and highly-compatible implementation of the Python programming language. | last year | 2461 | |
DottedDict Python library that provides a method of accessing lists and dicts with a dotted path notation. | last year | 168 | |
graphql-relay-py A library to help construct a graphql-py server supporting react-relay | last year | 145 | |
dev-setup macOS development environment setup: Easy-to-understand instructions with automated setup scripts for developer tools like Vim, Sublime Text, Bash, iTerm, Python data analysis, Spark, Hadoop MapReduc | last year | 6014 | android-developmentawsbash |
last year | 3 | ||
micropython-scd30 MicroPython I2C driver for SCD30 CO2 sensor module | last year | 23 | |
pandasql sqldf for pandas | last year | 1277 | |
missingno Missing data visualization module for Python. | last year | 3772 | data-analysisdata-visualizationmissing-data |
hamilton A scalable general purpose micro-framework for defining dataflows. THIS REPOSITORY HAS BEEN MOVED TO www.github.com/dagworks-inc/hamilton | last year | 878 | dagdata-engineeringdata-platform |
AMDH Android Mobile Device Hardening | last year | 188 | adbandroidandroid-hardening |
runlike Given an existing docker container, prints the command line necessary to run a copy of it. | last year | 1794 | dockerdocker-containerpython |
neural-networks-and-deep-learning Code samples for my book "Neural Networks and Deep Learning" | last year | 15029 | |
shortuuid A generator library for concise, unambiguous and URL-safe UUIDs. | last year | 1940 | |
pandaSDMX Python interface to SDMX | last year | 118 | |
fuzzywuzzy Fuzzy String Matching in Python | last year | 9029 | |
razi A cheminformatics extension for the SQLAlchemy database toolkit. | last year | 37 | |
mqtt-pwn MQTT-PWN intends to be a one-stop-shop for IoT Broker penetration-testing and security assessment operations. | last year | 318 | exploitationiotmqtt |
kitt The container based portable Shell environment | last year | 16 | bashcontainersdocker |
domato DOM fuzzer | last year | 1639 | domfuzzingsecurity |
micropython-i2c-ultrasonic A MicroPython driver for the RCWL-9620-based M5 I2C Ultrasonic Distance Unit | last year | 1 | |
w3af w3af: web application attack and audit framework, the open source web vulnerability scanner. | last year | 4443 | appseccross-site-scriptingscanner |
collective.workspace Restricted workspaces for Plone | last year | 7 | |
django-cache-machine Automatic caching and invalidation for Django models through the ORM. | last year | 868 | |
aioredis-py asyncio (PEP 3156) Redis support | last year | 2269 | aioredisasynciohacktoberfest |
aioredis-py asyncio (PEP 3156) Redis support | last year | 2277 | aioredisasynciohacktoberfest |
rtv Browse Reddit from your terminal | last year | 4632 | command-linecursespython |
crau Easy-to-use Web archiver | last year | 52 | |
micropyGPS A Full Featured GPS NMEA-0183 sentence parser for use with Micropython and the PyBoard embedded platform | last year | 331 | gpsgps-librarymicropython |
SH1106 MicroPython driver for the SH1106 OLED controller | last year | 145 | |
TensorLayer Deep Learning and Reinforcement Learning Library for Scientists and Engineers | last year | 7280 | a3cartificial-intelligencechatbot |
last year | 7 | micropythonpcf8563 | |
semantic-search-through-wikipedia-with-weaviate Semantic search through a vectorized Wikipedia (SentenceBERT) with the Weaviate vector search engine | last year | 214 | |
PcapViz Visualize network topologies and collect graph statistics based on pcap files | last year | 326 | network-topologypcappython |
python_lcd Python based library for talking to character based LCDs. | last year | 285 | |
skbel SKBEL - Bayesian Evidential Learning framework built on top of scikit-learn. | last year | 20 | bayesian-inferencegaussian-processgaussian-process-regression |
librectf CTF in a box. Minimal setup required. (not production-ready yet) | last year | 80 | |
flask-file-upload Easy file uploads for Flask. | last year | 151 | flaskflask-sqlalchemysqlalchemy |
flask-jwt-router Flask JWT Router is a Python library that adds authorised routes to a Flask app. | last year | 54 | flaskjwtpyjwt |
PyGrid-deprecated---see-PySyft- A Peer-to-peer Platform for Secure, Privacy-preserving, Decentralized Data Science | last year | 611 | peer-to-peerpygridpython |
python-user-agents A Python library that provides an easy way to identify devices like mobile phones, tablets and their capabilities by parsing (browser) user agent strings. | last year | 1393 | browser-detectionpythonuser-agent-detection |
Flask-GraphQL-Auth (UNMAINTAINED. FEEL FREE TO FORK) 🐍A Pythonic way to provide JWT authentication for Flask-GraphQL | last year | 63 | authextensionflask-extension |
Urban_PointCloud_Processing Repository for automatic classification and labeling of Urban PointClouds using data fusion and region growing techniques. | last year | 156 | 2d-data3d-dataclassification |
colorteller-aws-cdk reference for cdk implementation of the sample colorteller app provided by AWS | last year | 3 |